Navigation
Recommended by Funny Fellow
MIB Coub
All about #mib
eli_handle_b․wav
158 Followers
expfun_111
503 Followers
AI Coubs
#AI generated content: neuro art, music, video memes, deep fakes, etc.
Funny MC🎤
Funny Music Channel 🎶
Mashup
Sources are the materials that were used to create this coub.
Audio
eric robertspj byrnekatherine waterstonlukas haasfleajovan adepojean smartdiego calvabrad pittdamien chazellebabylon damien chazellebabylon movienew babylon trailerbabylon trailerbabylonmashupmashupshybridstrailerbattleradiocoubsradio coubradiocoubradio coubsday & nightday and nightdays and nightsdays & nightsday n nightday 'n' nightday 'n' niteday&nightdayandnightdaynnightday'n'nightwaiting for the nightnelly furtadoaladdindisney's aladdindisneyaladdin 2019aladdin 2019 moviemagic carpetlike a bossievan polkkadancefunny dancemoby lift me upmoby - lift me uplift me uparabian nightsarabian nightchacarron macarronel mudo - chacarron macarronel mudo chacarron macarronаладдиналаддин гая ричиаладдин 2019аладдин фильмдиснейвавилонковёр-самолётдень и ночьдни и ночи
Day & Night (x3 + bonus)
Mashup
Sources are the materials that were used to create this coub.
scenewarscene warproceduresprocedurethe punisherpunishercaucasian captiveussr filmsoviet moviemashupmashupshybridscrossovercrossoversrussianhybridsrussianhollywoodrussian hybridsrussian hollywoodmosfilmmosfilm (production company)hollywood vs мосфильмhollywood vs. mosfilmnetflixmarvelmarvel comicsmarvel universeкавказская пленницауколыуколукол в попуукол в жопкууколрусскиепроцедурыпроцедураno no nono nono no no nonononono no no no nonononononononononowait waitwaitwait wait waitmemememespunisher netflixthe punisher scenethe punisher netflixthe punisher seriesno no no memeмарш троицыбывалыйкарательнаши люди в голливудемосфильммосфильм vs hollywoodмосфильм против голливудамосфильм vs голливудмосфильмпротивголливудамосфильм комедиясоветские комедииsoviet comedy filmsoviet comedycomedyinjectionsinjectionthe punisher season 1the punisher (series)the punisher tv seriesdream sequence scenedream sequencepunisher series
Injections
Mashup
Sources are the materials that were used to create this coub.
Audio
Don't shoot!
Mashup
under tablewho's harry crumb? (film)who's harry crumb?who's harry crumbfeetdinner scenemarvelnetflixjudassequencedreamepisodepunisherthe punishermarvel studiosmarvel universecomedymashupmashupshybridsscenewarscene warlove me tenderlove me tender (composition)elvis presley love me tenderelvis presley - love me tenderfoot fetishpainhurtпод столомпод столом))ногиболькто такой гарри крамбкаратель
Nutcracker
Hotline
Mashup
Sources are the materials that were used to create this coub.
i am legendwill smithcalendar3rd septemberscene warscenewarmashupmashupshybridsshufutinskiyshufutinskishufutinsky mihailmihail shafitinskykalendarkalenderkalendár3 september3 sept3sept3septemberseptember3september 3september 3rdseptember 3 (day of year)sep 3sept3sept 3i am legend - home scenecrossoverrussianhybridsrussianhollywoodrussian hollywoodrussian hybridsrussia meets hollywoodmemememesmeme songнаши люди в голливудемихаил шуфутинскиймихаил шуфутинский 3 сентября3 сентября3 сентября михаил шуфутинский3 сентября мем3 сентября прикол3 сентября шуфутинскийшуфутинский3-е сентября3-е сентября крид3 сентября какой сегодня день3 сентября мэшап3 сентября клип3 сентября кавер3 сентября песня3 сентября 2022уилл смитя легендатвтелевизоркалендарья календарья календарь перевернукалендарь перевернукостры рябиндень прощаниядень прощаньясовсем один3сентября3сентября шуфутинский3сентября)))robert nevillezoe nevilleшансонchansonтретье сентябрятретье сентября мемтретье сентября coverтретье сентября кавертретье сентября приколлегендалегендарный мемлегендарныйлегендарный трек)легендарный фильмlegendarycoublegendary musiclegendary coublegendary collectionlegendary content
September 3rd (I'm a Calendar)
Live Pictures
Sources are the materials that were used to create this coub.
Audio
trailerthe bob's burgers moviesummersummertimesummer is oversummer is endingsummer goodbyesummer vibessummer musicsummer timesummer is goingsummer has comesummer is coming soonзакусочная бобалетоlive picturescartooncartoonsmicrocoubsmicrocoubmicro coubmicro coubscinemagraphcinemagraphswait for the mixwaitforthemixdon't wait for the mixpiano coverinstrumentalsamba de janeirodancingdancebob`s burgers
Summer
Mashup
Sources are the materials that were used to create this coub.
ᴅʀ. ʟɪᴠᴇsᴇʏ ɪɴ ᴛʜᴇ ᴍᴀᴛʀɪx
Mashup
Sources are the materials that were used to create this coub.
уэнздиуэнзди аддамсуэнздей аддамсмемымемтоби магуайрпитер паркерчеловек-паукчеловек паукpiter parkerspider man 2spider-man 2музыкальный коубмузыкакрикпаукspider girl spiderman girlspider girlspidermarvel universeshe-venommarvel studiosa tribe called redattacca quartetelectric pow wow drumgoodtiminggood timingmemesmemespider-man memespider manspiderman 2spidermantobey maguire screamtobey maguire screamingscreamingscreamtrailerbattlemovie momentsupcoming moviesmeme musicsmilemixmusicmcumarvelantiherodarkmashupmashupshybridswednesday addamswednesdaytrailertim burtonteasernetflixjenna ortegatobey maguirespider-mancellocello covercello (musical instrument)cello acoustic coverвиолончельвиолончелисткаclassical crossover
She-Venom
Mashup
Sources are the materials that were used to create this coub.
A little cool for such a hot summer
Cartoons
Sources are the materials that were used to create this coub.
Video
cartoon mashupscartoon mashuphybridsmashupsmashupmen in black the series intromen in black the series thememen in black the seriesmen in black: the seriesmib men in blackmib люди в чёрномmib series openingmib the seriesmib series introcartoonsmib animationmib coubsmib coubmibrick and morty trailernew rick and mortymecha rickall new rick and mortyrick and jerrybeth clonejerrybethsummermortyricksarah chalkechris parnelljustin roilanddan harmonwatch rick and mortyrick and morty season 6rick & mortyrick and mortyadult swim officialanimated showwatch comedywatch animationwatch adult swimcomedy seriesanimated seriesanimatedcomedyadult animationanimationadult swimtrailerbattleлюди в черномлюди в чёрномлюди в черном сериаллюди в чёрном мультфильмлюди в черном сериал интролюди в черном мультфильм.рик и мортирик и морти новый сезонрик и морти мультик
MIB vs. R&M
так круто, пока смотрел, тарелку с супом перевернул
Movies & TV
Sources are the materials that were used to create this coub.
wait for the mixwaitforthemixwftmpmcoubspider-man no way homespider-man no way home (2021)spider-manzendayatobey maguirewhy not?jupiterjupiter parkerpeter parkerчеловек-паук нет пути домойчеловек-паукчеловек паукзендаятоби магуайрюпитерwtfwhat the fmovie coubmusic coubspaceplanetпланетаmarsh - another planet (ft. sun ra)
Jupiter Parker...
Mashup
Sources are the materials that were used to create this coub.
Video
youtubepimpmyridexzibithavefunmtvmtv ukmtv nostalgiamtv rewindmtv throwbackpimp my ridecarspimp my ride best reactionspimp my ride best carspimp my ride best pimpspimp my ride funnypimp my ride funny momentspimp my ride full episodespimp my ride crazy carscars on the roadbb8bb8_bdaybb8 bdaybb8's birthdaytrailerbattlemashupmashupshybridshappy birthdayhappy birthday coubanimationanimationsdisneydisney+disney pixardisney pixar carsdisney animationpixarpixar animation studiospixar animationс днём рожденияс днём рождения!с днем рожденияс днем рождения!дрпоздравлениепоздравление с днем рождениятачкитачки под музыкутачка на прокачкутачку на прокачкуиксзибитcouber's lifecouber's life v2couber's life in 2022couber's life coubers-lifecoubercouberscoubers lifecoubers-lifecoubers'lifecoubers_lifecouberslife v2coubers's lifecoubers life v2couberslife
Congratulations! #bb8 #bb8_bday #trailerbattle
Mashup
darth vaderlostollietrailerginarodriguezjonathangroffmaryjbligejakejohnsonfamilyshowollieswstar warstrailerbattlemashupmashupshybridsnetflixlucasfilmi am your fathermemememeslightsaberlightsaberslightsaber duellightsaber battlelightsaber fightdarthvaderdart waderstar wars: episode vdark lordlost ollielost ollie official trailerstuffed toyjediclassic memeswmemestar wars memesstar wars meme
Darth Ollie
Mashup
Sources are the materials that were used to create this coub.
gta 5the expendables 5the expendables 4the expendables 3 ostcome with me nowcome with me now - kongoscome with me now kongoscome with me now musicthe expendablesgta wastedgta5 wastedgta 5 wasted effectmashupshybridsmusictrailerbattlepulp fictionbutchbruce willissilvester stallonestalloneslywillisбрюс уиллиссильвестр сталлонеwastedпотраченосамаритянин 2022самаритянин трейлер 2022самаритянинсталоннесталонесталлонеmashupamazonprimeamazon primeamazon prime videoprime videoaction movieaction filmactionprime video samaritansamaritan prime videonew amazon trailerprime video official trailertrailer 2022official trailer 2022trailerofficial trailersamaritansamaritan trailersamaritan official trailerrock music (film genre)pulp fiction (award-winning work)криминальное чтиво
The Expendables 5
Cartoons
Sources are the materials that were used to create this coub.
Video
marvelcomicssan diego comic-consdcccomic-concomicconcomic consan diegolive streamsdcc livesdcc 2022san diego comic-con 2022filmnetflix filmadventureanimationcate blanchettchristoph waltzcircuscraftdavid bradleyewan mcgregorfairyfairy talefamilyfinn wolfhardfound familygepettogregory mannguillermo del toroguillermo del toro's pinocchiolovemagicmarionettemusicmusicalnetflix 2022netflix animationnetflix familynetflix trailerpinocchiopuppetron perlmansecond chancesingingstop motiontilda swintonwoodcarvertrailerbattlemashupmashupshybridscartoonscartoon mashupcartoon mashupsgrooti am grooti am groot!i am grootei am grutgroot guardiansgroot scenesgroot (film character)groot marvelgroot trailerbaby grootbaby groot sceneupcoming movieswooden boyпиноккиогрутhellohello motherfuckerhello motherfucker!hello motherfuckahello memehello motherfucker kidhello mazafakahello mazafaka c'monя есть грутnetflixmarvel studiosmarvel universe
Wooden boys
RemixMashup
Sources are the materials that were used to create this coub.
laterspongbob cardsdoctor whodoctor who 1111th doctormath smithmorbiusmorbius 2022mashupmashupshybridsvampirevampiresfantasticfantasysuperhero moviemarvelmarvel studiosmarvel universebbcactionaction sceneaction scenesdalekexterminateexterminate!i need a doctori need a doctor remixi need a doctor(remix)trap remixbesomorphremixthe doctorthe doctor whosubway fight scenesubway sceneexterminatedдоктор ктодалекдаликморбиусморбиус фильммэтт смитмэтт смиттмэтт смит доктор ктовампирвампирывампирши
Doctor Vamp
Mashup
Sources are the materials that were used to create this coub.
marvel studiosmarvel universejared letomarvelfantasticcomedysubway scenesubway scenessubwayscene warscenewarhybridsmashupsmashupmorbiusghostbusters 2ghostbustershalloweenfilmscenesmoviescenesghostsonysonypicturesivanreitmanrickmoraniserniehudsonharoldramisdanaykroydbillmurrayimmigrant songimmigrant song led zeppelinled zeppelin - immigrant songled zeppelin immigrant songscreamscreamingscreameraaah songmusic loopcrossover
Subway accident
Mashup
Sources are the materials that were used to create this coub.
back in timevampire diariesmorbiusprince of persiasands of timeprince of persia sands of timemashupmashupshybridsvv brownostscenewarsubway scenemusic coubfantasyfantasticmarvelmarvel studiosmarvel universedisneydisney studiosморбиусморбиус фильмпринц персиипринц персии: пески временипринц персии пески временипески времениджилленхолджилленхоллджейк джилленхолджейк джиленхоллджейк джилленхоллджейк джиленхолджарет леттоджаред летоджаретт летоджаретлетоjake gyllenhaaljared leto morbiusjared leto
Back In Time